Lineage for d1bypa_ (1byp A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Plastocyanin [49507] (14 species) 
Species White campion (Silene pratensis) [TaxId:52853] [49512] (2 PDB entries) 
Domain d1bypa_: 1byp A: [22858]
Details for d1bypa_
PDB Entry: 1byp (more details), 1.75 Å
PDB Description: e43k,d44k double mutant plastocyanin from silene
SCOP Domain Sequences for d1bypa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis)}
aevllgssdgglafvpsdlsiasgekitfknnagfphndlfdkkevpagvdvtkismpee
dllnapgeeysvtltekgtykfycaphagagmvgkvtvn
SCOP Domain Coordinates for d1bypa_:
Click to download the PDB-style file with coordinates for d1bypa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bypa_:
- d1bypa_ appears in SCOP 1.57
- d1bypa_ appears in the current release, SCOPe 2.08
View in 3D