![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
![]() | Protein automated matches [226867] (22 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:1772] [228578] (2 PDB entries) |
![]() | Domain d4baed_: 4bae D: [228579] automated match to d4emva_ complexed with ca, rwx, so4 |
PDB Entry: 4bae (more details), 2.35 Å
SCOPe Domain Sequences for d4baed_:
Sequence, based on SEQRES records: (download)
>d4baed_ d.122.1.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 1772]} gleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsvevrddg rgipvemhatgmptidvvmtqlhaggkfdgetyavsgglhgvgvsvvnalstrleatvlr dgyewfqyydrsvpgklkqggetketgttirfwadpeifettdynfetvarrlqemafln kgltieltderdgkhrvfhypg
>d4baed_ d.122.1.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 1772]} gleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsvevrddg rgipvemhatgmptidvvmtqlhgvgvsvvnalstrleatvlrdgyewfqyydrsvpgkl kqggetketgttirfwadpeifettdynfetvarrlqemaflnkgltieltderdgkhrv fhypg
Timeline for d4baed_: