Lineage for d3zcfb_ (3zcf B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1476828Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1477026Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1477137Species Human (Homo sapiens) [TaxId:9606] [109644] (4 PDB entries)
    Uniprot P99999
  8. 1477143Domain d3zcfb_: 3zcf B: [228575]
    automated match to d1j3sa_
    complexed with hec

Details for d3zcfb_

PDB Entry: 3zcf (more details), 1.65 Å

PDB Description: Structure of recombinant human cytochrome c
PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d3zcfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zcfb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d3zcfb_:

Click to download the PDB-style file with coordinates for d3zcfb_.
(The format of our PDB-style files is described here.)

Timeline for d3zcfb_: