| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Mitochondrial cytochrome c [46642] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [109644] (13 PDB entries) Uniprot P99999 |
| Domain d3zcfa_: 3zcf A: [228574] automated match to d1j3sa_ complexed with hec |
PDB Entry: 3zcf (more details), 1.65 Å
SCOPe Domain Sequences for d3zcfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zcfa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
Timeline for d3zcfa_: