Lineage for d3zcfd_ (3zcf D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257170Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1257365Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1257467Species Human (Homo sapiens) [TaxId:9606] [109644] (4 PDB entries)
    Uniprot P99999
  8. 1257475Domain d3zcfd_: 3zcf D: [228572]
    automated match to d1j3sa_
    complexed with hec

Details for d3zcfd_

PDB Entry: 3zcf (more details), 1.65 Å

PDB Description: Structure of recombinant human cytochrome c
PDB Compounds: (D:) cytochrome c

SCOPe Domain Sequences for d3zcfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zcfd_ a.3.1.1 (D:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d3zcfd_:

Click to download the PDB-style file with coordinates for d3zcfd_.
(The format of our PDB-style files is described here.)

Timeline for d3zcfd_: