Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (24 species) not a true protein |
Species Tylonycteris bat coronavirus hku4 [TaxId:694007] [228570] (6 PDB entries) |
Domain d2ynaa_: 2yna A: [228571] automated match to d3ea8a_ complexed with gol, imd, ni |
PDB Entry: 2yna (more details), 1.5 Å
SCOPe Domain Sequences for d2ynaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ynaa_ b.47.1.0 (A:) automated matches {Tylonycteris bat coronavirus hku4 [TaxId: 694007]} sglvkmsapsgavencivqvtcgsmtlnglwldntvwcprhimcpadqltdpnydallis ktnhsfivqkhigaqanlrvvahsmvgvllkltvdvanpstpaytfstvkpgasfsvlac yngkptgvftvnlrhnstikgsflcgscgsvgytenggvinfvymhqmelsngthtgssf dgvmygafedkqthqlqltdkyctinvvawlyaavlngckwfvkptrvgivtynewalsn qftefvgtqsidmlahrtgvsveqmlaaiqslhagfqgktilgqstledeftpddvnmqv mgvvmq
Timeline for d2ynaa_: