Lineage for d1ag6__ (1ag6 -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11048Protein Plastocyanin [49507] (14 species)
  7. 11089Species Spinach (Spinacia oleracea) [TaxId:3562] [49511] (1 PDB entry)
  8. 11090Domain d1ag6__: 1ag6 - [22857]

Details for d1ag6__

PDB Entry: 1ag6 (more details), 1.7 Å

PDB Description: plastocyanin from spinach

SCOP Domain Sequences for d1ag6__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ag6__ b.6.1.1 (-) Plastocyanin {Spinach (Spinacia oleracea)}
vevllggddgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
dllnapgetykvtltekgtykfycsphqgagmvgkvtvn

SCOP Domain Coordinates for d1ag6__:

Click to download the PDB-style file with coordinates for d1ag6__.
(The format of our PDB-style files is described here.)

Timeline for d1ag6__: