Lineage for d3vxqd2 (3vxq D:114-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750501Domain d3vxqd2: 3vxq D:114-204 [228563]
    Other proteins in same PDB: d3vxqa1, d3vxqb1, d3vxqb2, d3vxqd1, d3vxqe1, d3vxqe2
    automated match to d2pyfa2

Details for d3vxqd2

PDB Entry: 3vxq (more details), 2 Å

PDB Description: H27-14 TCR specific for HLA-A24-Nef134-10
PDB Compounds: (D:) H27-14 TCR alpha chain

SCOPe Domain Sequences for d3vxqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vxqd2 b.1.1.2 (D:114-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspe

SCOPe Domain Coordinates for d3vxqd2:

Click to download the PDB-style file with coordinates for d3vxqd2.
(The format of our PDB-style files is described here.)

Timeline for d3vxqd2: