Lineage for d3vxqd1 (3vxq D:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519679Domain d3vxqd1: 3vxq D:1-113 [228562]
    Other proteins in same PDB: d3vxqa2, d3vxqd2
    automated match to d2pyfa1

Details for d3vxqd1

PDB Entry: 3vxq (more details), 2 Å

PDB Description: H27-14 TCR specific for HLA-A24-Nef134-10
PDB Compounds: (D:) H27-14 TCR alpha chain

SCOPe Domain Sequences for d3vxqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vxqd1 b.1.1.0 (D:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsg
rlnasldkssgrstlyiaasqpgdsatylcavrmdssyklifgsgtrllvrpd

SCOPe Domain Coordinates for d3vxqd1:

Click to download the PDB-style file with coordinates for d3vxqd1.
(The format of our PDB-style files is described here.)

Timeline for d3vxqd1: