SCOPe 2.03: Domain d4mayb1: 4may B:3-94

Lineage for d4mayb1 (4may B:3-94)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (19 PDB entries)

8. Domain d4mayb1: 4may B:3-94 [228556]
   Other proteins in same PDB: d4maya2, d4mayb2, d4mayc1, d4mayc2
   automated match to d1jk8b2
   complexed with so4

Details for d4mayb1

PDB Entry: 4may, 2.2 Å

PDB Description: crystal structure of an immune complex

PDB Compounds: (B:) MHC class II antigen

SCOPe Domain Sequences for d4mayb1:

Sequence; same for both SEQRES and ATOM records:

>d4mayb1 d.19.1.1 (B:3-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyravtpqgrpvaeywn
sqkevlegarasvdrvcrhnyevayrgilqrr

Timeline for d4mayb1:

• d4mayb1 is new in SCOPe 2.03-stable
  
• d4mayb1 appears in SCOPe 2.04
  
• d4mayb1 appears in the current release, SCOPe 2.08