SCOPe 2.08: Domain d4maya2: 4may A:82-180

Lineage for d4maya2 (4may A:82-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4maya2: 4may A:82-180 [228550]
   Other proteins in same PDB: d4maya1, d4mayb1, d4mayc1
   automated match to d1uvqa1
   complexed with so4

Details for d4maya2

PDB Entry: 4may, 2.2 Å

PDB Description: crystal structure of an immune complex

PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d4maya2:

Sequence; same for both SEQRES and ATOM records:

>d4maya2 b.1.1.2 (A:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsngqsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldqpllkhwep

Timeline for d4maya2:

• d4maya2 first appeared in SCOPe 2.03
  
• d4maya2 appears in SCOPe 2.07