SCOP 1.73: Domain d1plaa_: 1pla A:

Lineage for d1plaa_ (1pla A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (14 species)

7. Species Parsley (Petroselinum crispum) [TaxId:4043] [49510] (2 PDB entries)

8. Domain d1plaa_: 1pla A: [22855]
   complexed with cu

Details for d1plaa_

PDB Entry: 1pla

PDB Description: high-resolution solution structure of reduced parsley plastocyanin

PDB Compounds: (A:) plastocyanin

SCOP Domain Sequences for d1plaa_:

Sequence; same for both SEQRES and ATOM records:

>d1plaa_ b.6.1.1 (A:) Plastocyanin {Parsley (Petroselinum crispum) [TaxId: 4043]}
aevklgsddgglvfspssftvaagekitfknnagfphnivfdedevpagvnaekisqpey
lngagetyevtltekgtykfycephagagmkgevtvn

Timeline for d1plaa_:

• d1plaa_ first appeared (with stable ids) in SCOP 1.55, called d1pla__
  
• d1plaa_ was called d1pla__ in SCOP 1.71
  
• d1plaa_ appears in SCOP 1.75
  
• d1plaa_ appears in the current release, SCOPe 2.08