Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries) |
Domain d4maya1: 4may A:0-81 [228549] Other proteins in same PDB: d4maya2, d4mayb2, d4mayc1, d4mayc2 automated match to d1uvqa2 complexed with so4 |
PDB Entry: 4may (more details), 2.2 Å
SCOPe Domain Sequences for d4maya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4maya1 d.19.1.1 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqga lrnmavakhnlnimikrynsta
Timeline for d4maya1:
View in 3D Domains from other chains: (mouse over for more information) d4mayb1, d4mayb2, d4mayc1, d4mayc2 |