SCOPe 2.08: Domain d4maya1: 4may A:0-81

Lineage for d4maya1 (4may A:0-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)

8. Domain d4maya1: 4may A:0-81 [228549]
   Other proteins in same PDB: d4maya2, d4mayb2, d4mayc1, d4mayc2
   automated match to d1uvqa2
   complexed with so4

Details for d4maya1

PDB Entry: 4may, 2.2 Å

PDB Description: crystal structure of an immune complex

PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d4maya1:

Sequence; same for both SEQRES and ATOM records:

>d4maya1 d.19.1.1 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqga
lrnmavakhnlnimikrynsta

Timeline for d4maya1:

• d4maya1 first appeared in SCOPe 2.03
  
• d4maya1 appears in SCOPe 2.07