Lineage for d4maya1 (4may A:0-81)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2507461Protein automated matches [191280] (4 species)
    not a true protein
  7. 2507471Species Human (Homo sapiens) [TaxId:9606] [189896] (25 PDB entries)
  8. 2507491Domain d4maya1: 4may A:0-81 [228549]
    Other proteins in same PDB: d4maya2, d4mayb2, d4mayc1, d4mayc2
    automated match to d1uvqa2
    complexed with so4

Details for d4maya1

PDB Entry: 4may (more details), 2.2 Å

PDB Description: crystal structure of an immune complex
PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d4maya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4maya1 d.19.1.1 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqga
lrnmavakhnlnimikrynsta

SCOPe Domain Coordinates for d4maya1:

Click to download the PDB-style file with coordinates for d4maya1.
(The format of our PDB-style files is described here.)

Timeline for d4maya1: