SCOPe 2.08: Domain d4mayc2: 4may C:114-192

Lineage for d4mayc2 (4may C:114-192)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4mayc2: 4may C:114-192 [228548]
   Other proteins in same PDB: d4maya1, d4mayb1, d4mayc1
   automated match to d2f54d2
   complexed with so4

Details for d4mayc2

PDB Entry: 4may, 2.2 Å

PDB Description: crystal structure of an immune complex

PDB Compounds: (C:) HY.1B11 TCR alpha chain

SCOPe Domain Sequences for d4mayc2:

Sequence; same for both SEQRES and ATOM records:

>d4mayc2 b.1.1.2 (C:114-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnns

Timeline for d4mayc2:

• d4mayc2 first appeared in SCOPe 2.03
  
• d4mayc2 appears in SCOPe 2.07