SCOPe 2.03: Domain d4mayc1: 4may C:2-113

Lineage for d4mayc1 (4may C:2-113)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d4mayc1: 4may C:2-113 [228547]
   Other proteins in same PDB: d4maya1, d4maya2, d4mayb1, d4mayb2, d4mayc2
   automated match to d2f54d1
   complexed with so4

Details for d4mayc1

PDB Entry: 4may, 2.2 Å

PDB Description: crystal structure of an immune complex

PDB Compounds: (C:) HY.1B11 TCR alpha chain

SCOPe Domain Sequences for d4mayc1:

Sequence; same for both SEQRES and ATOM records:

>d4mayc1 b.1.1.0 (C:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enveqhpstlsvqegdsavikctysdsasnyfpwykqelgkrpqliidirsnvgekkdqr
iavtlnktakhfslhitetqpedsavyfcaassfgnekltfgtgtrltiipn

Timeline for d4mayc1:

• d4mayc1 is new in SCOPe 2.03-stable
  
• d4mayc1 appears in SCOPe 2.04
  
• d4mayc1 appears in the current release, SCOPe 2.08