Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d4mayc1: 4may C:2-113 [228547] Other proteins in same PDB: d4maya1, d4maya2, d4mayb1, d4mayb2, d4mayc2 automated match to d2f54d1 complexed with so4 |
PDB Entry: 4may (more details), 2.2 Å
SCOPe Domain Sequences for d4mayc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mayc1 b.1.1.0 (C:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]} enveqhpstlsvqegdsavikctysdsasnyfpwykqelgkrpqliidirsnvgekkdqr iavtlnktakhfslhitetqpedsavyfcaassfgnekltfgtgtrltiipn
Timeline for d4mayc1:
View in 3D Domains from other chains: (mouse over for more information) d4maya1, d4maya2, d4mayb1, d4mayb2 |