SCOPe 2.07: Domain d4mlha2: 4mlh A:219-461

Lineage for d4mlha2 (4mlh A:219-461)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Glucokinase [102479] (1 species)
   Hexokinase D

7. Species Human (Homo sapiens) [TaxId:9606] [102480] (6 PDB entries)

8. Domain d4mlha2: 4mlh A:219-461 [228545]
   Other proteins in same PDB: d4mlha3
   automated match to d1v4sa2
   complexed with glc, vo2

Details for d4mlha2

PDB Entry: 4mlh, 2.9 Å

PDB Description: human glucokinase in complex with a novel amino thiazole allosteric activator

PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d4mlha2:

Sequence; same for both SEQRES and ATOM records:

>d4mlha2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens) [TaxId: 9606]}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs
edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack
kac

Timeline for d4mlha2:

• d4mlha2 first appeared in SCOPe 2.03
  
• d4mlha2 appears in SCOPe 2.06
  
• d4mlha2 appears in the current release, SCOPe 2.08