Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.3: Hexokinase [53083] (3 proteins) |
Protein Glucokinase [102479] (1 species) Hexokinase D |
Species Human (Homo sapiens) [TaxId:9606] [102480] (6 PDB entries) |
Domain d4mlha2: 4mlh A:219-461 [228545] automated match to d1v4sa2 complexed with glc, vo2 |
PDB Entry: 4mlh (more details), 2.9 Å
SCOPe Domain Sequences for d4mlha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mlha2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack kac
Timeline for d4mlha2: