![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.3: Hexokinase [53083] (3 proteins) |
![]() | Protein Glucokinase [102479] (1 species) Hexokinase D |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102480] (6 PDB entries) |
![]() | Domain d4mlha1: 4mlh A:16-218 [228544] Other proteins in same PDB: d4mlha3 automated match to d1v4sa1 complexed with glc, vo2 |
PDB Entry: 4mlh (more details), 2.9 Å
SCOPe Domain Sequences for d4mlha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mlha1 c.55.1.3 (A:16-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} veqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgdfl sldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdfld khqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrgdf emdvvamvndtvatmiscyyedh
Timeline for d4mlha1: