Lineage for d4mlea2 (4mle A:219-461)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884234Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 2884235Protein Glucokinase [102479] (1 species)
    Hexokinase D
  7. 2884236Species Human (Homo sapiens) [TaxId:9606] [102480] (6 PDB entries)
  8. 2884244Domain d4mlea2: 4mle A:219-461 [228543]
    Other proteins in same PDB: d4mlea3
    automated match to d1v4sa2
    complexed with glc, vo1

Details for d4mlea2

PDB Entry: 4mle (more details), 2.6 Å

PDB Description: human glucokinase in complex with novel amino thiazole activator
PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d4mlea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mlea2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens) [TaxId: 9606]}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs
edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack
kac

SCOPe Domain Coordinates for d4mlea2:

Click to download the PDB-style file with coordinates for d4mlea2.
(The format of our PDB-style files is described here.)

Timeline for d4mlea2: