SCOPe 2.06: Domain d4me7d1: 4me7 D:2-114

Lineage for d4me7d1 (4me7 D:2-114)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (4 proteins)
   automatically mapped to Pfam PF02452

6. Protein automated matches [228538] (6 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [228539] (1 PDB entry)

8. Domain d4me7d1: 4me7 D:2-114 [228540]
   Other proteins in same PDB: d4me7a2, d4me7b2, d4me7c2, d4me7d2
   automated match to d1ne8a_
   protein/RNA complex

Details for d4me7d1

PDB Entry: 4me7, 2.92 Å

PDB Description: crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze

PDB Compounds: (D:) mRNA interferase EndoA

SCOPe Domain Sequences for d4me7d1:

Sequence, based on SEQRES records:

>d4me7d1 b.34.6.2 (D:2-114) automated matches {Bacillus subtilis [TaxId: 224308]}
ivkrgdvyfadlspvvgseqggvrpvlviqndignrfsptaivaaitaqiqkaklpthve
idakrygferdsvilleqirtidkqrltdkithlddemmdkvdealqislali

Sequence, based on observed residues (ATOM records):

>d4me7d1 b.34.6.2 (D:2-114) automated matches {Bacillus subtilis [TaxId: 224308]}
ivkrgdvyfadvrpvlviqndignrfsptaivaaitaqiqkaklpthveidakrygferd
svilleqirtidkqrltdkithlddemmdkvdealqislali

Timeline for d4me7d1:

• d4me7d1 first appeared in SCOPe 2.03, called d4me7d_
  
• d4me7d1 was called d4me7d_ in SCOPe 2.05
  
• d4me7d1 appears in SCOPe 2.07
  
• d4me7d1 appears in the current release, SCOPe 2.08