Lineage for d4me7d1 (4me7 D:2-114)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784312Family b.34.6.2: Kid/PemK [82075] (4 proteins)
    automatically mapped to Pfam PF02452
  6. 2784335Protein automated matches [228538] (6 species)
    not a true protein
  7. 2784339Species Bacillus subtilis [TaxId:224308] [228539] (1 PDB entry)
  8. 2784343Domain d4me7d1: 4me7 D:2-114 [228540]
    Other proteins in same PDB: d4me7a2, d4me7b2, d4me7c2, d4me7d2
    automated match to d1ne8a_
    protein/RNA complex

Details for d4me7d1

PDB Entry: 4me7 (more details), 2.92 Å

PDB Description: crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze
PDB Compounds: (D:) mRNA interferase EndoA

SCOPe Domain Sequences for d4me7d1:

Sequence, based on SEQRES records: (download)

>d4me7d1 b.34.6.2 (D:2-114) automated matches {Bacillus subtilis [TaxId: 224308]}
ivkrgdvyfadlspvvgseqggvrpvlviqndignrfsptaivaaitaqiqkaklpthve
idakrygferdsvilleqirtidkqrltdkithlddemmdkvdealqislali

Sequence, based on observed residues (ATOM records): (download)

>d4me7d1 b.34.6.2 (D:2-114) automated matches {Bacillus subtilis [TaxId: 224308]}
ivkrgdvyfadvrpvlviqndignrfsptaivaaitaqiqkaklpthveidakrygferd
svilleqirtidkqrltdkithlddemmdkvdealqislali

SCOPe Domain Coordinates for d4me7d1:

Click to download the PDB-style file with coordinates for d4me7d1.
(The format of our PDB-style files is described here.)

Timeline for d4me7d1: