Lineage for d4lwba_ (4lwb A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2236062Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2236063Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2236064Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2236862Protein automated matches [190421] (6 species)
    not a true protein
  7. 2236868Species Bacillus subtilis [TaxId:224308] [228529] (68 PDB entries)
  8. 2236909Domain d4lwba_: 4lwb A: [228530]
    automated match to d1m7va_
    complexed with cl, gol, h4b, hem, qj8

Details for d4lwba_

PDB Entry: 4lwb (more details), 2.15 Å

PDB Description: structure of bacillus subtilis nitric oxide synthase in complex with 6-((((3r,5s)-5-(((6-amino-4-methylpyridin-2-yl)methoxy)methyl) pyrrolidin-3-yl)oxy)methyl)-4-methylpyridin-2-amine
PDB Compounds: (A:) Nitric oxide synthase oxygenase

SCOPe Domain Sequences for d4lwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lwba_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
eekeilwneakafiaacyqelgkaaevkdrladikseidltgsyvhtkeelehgakmawr
nsnrcigrlfwnslnvidrrdvrtkeevrdalfhhietatnngkirptitifppeekgek
qveiwnhqliryagyesdgerigdpascsltaaceelgwrgertdfdllplifrmkgdeq
pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg
teigarnladekrydklkkvasvigiaadyntdlwkdqalvelnkavlhsykkqgvsivd
hhtaasqfkrfeeqaeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp
ye

SCOPe Domain Coordinates for d4lwba_:

Click to download the PDB-style file with coordinates for d4lwba_.
(The format of our PDB-style files is described here.)

Timeline for d4lwba_: