Lineage for d4pcy__ (4pcy -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Plastocyanin [49507] (14 species) Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (8 PDB entries) 
Domain d4pcy__: 4pcy - [22853]
Details for d4pcy__
PDB Entry: 4pcy (more details), 2.15 Å
PDB Description: crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
SCOP Domain Sequences for d4pcy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pcy__ b.6.1.1 (-) Plastocyanin {Poplar (Populus nigra), variant italica}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn
SCOP Domain Coordinates for d4pcy__:
Click to download the PDB-style file with coordinates for d4pcy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4pcy__:
- d4pcy__ appears in SCOP 1.57
- d4pcy__ appears in the current release, SCOPe 2.08, called d4pcya_
View in 3D