SCOPe 2.06: Domain d4m63d2: 4m63 D:147-374

Lineage for d4m63d2 (4m63 D:147-374)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries)

8. Domain d4m63d2: 4m63 D:147-374 [228527]
   Other proteins in same PDB: d4m63c1, d4m63d1, d4m63e1
   automated match to d2btfa2
   complexed with atp, ca

Details for d4m63d2

PDB Entry: 4m63, 2.75 Å

PDB Description: crystal structure of a filament-like actin trimer bound to the bacterial effector vopl

PDB Compounds: (D:) Actin-5C

SCOPe Domain Sequences for d4m63d2:

Sequence; same for both SEQRES and ATOM records:

>d4m63d2 c.55.1.1 (D:147-374) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmeacgihettynsimkcaaairkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkc

Timeline for d4m63d2:

• d4m63d2 first appeared in SCOPe 2.03
  
• d4m63d2 appears in SCOPe 2.05
  
• d4m63d2 appears in SCOPe 2.07
  
• d4m63d2 appears in the current release, SCOPe 2.08