SCOPe 2.03: Domain d4m63d1: 4m63 D:5-146

Lineage for d4m63d1 (4m63 D:5-146)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226691] (2 PDB entries)

8. Domain d4m63d1: 4m63 D:5-146 [228526]
   Other proteins in same PDB: d4m63c2, d4m63d2, d4m63e2
   automated match to d2btfa1
   complexed with atp, ca

Details for d4m63d1

PDB Entry: 4m63, 2.75 Å

PDB Description: crystal structure of a filament-like actin trimer bound to the bacterial effector vopl

PDB Compounds: (D:) Actin-5C

SCOPe Domain Sequences for d4m63d1:

Sequence, based on SEQRES records:

>d4m63d1 c.55.1.0 (D:5-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf
etfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d4m63d1 c.55.1.0 (D:5-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vaalvvdngsgmckagfagddapravfpsivgrprhkdsyvgdeaqskrgiltlkypieh
givtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamy
vaiqavlslyasg

Timeline for d4m63d1:

• d4m63d1 is new in SCOPe 2.03-stable
  
• d4m63d1 appears in SCOPe 2.04
  
• d4m63d1 appears in the current release, SCOPe 2.08