Lineage for d4lsic_ (4lsi C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251383Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2251501Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2251502Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2251503Protein Porin [56937] (5 species)
  7. 2251506Species Escherichia coli, different sequences [TaxId:562] [56938] (27 PDB entries)
  8. 2251526Domain d4lsic_: 4lsi C: [228520]
    automated match to d4gcsa_
    complexed with br, c8e, gol, mg, peg

Details for d4lsic_

PDB Entry: 4lsi (more details), 2.09 Å

PDB Description: Ion selectivity of OmpF porin soaked in 0.3M KBr
PDB Compounds: (C:) Outer membrane protein F

SCOPe Domain Sequences for d4lsic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lsic_ f.4.3.1 (C:) Porin {Escherichia coli, different sequences [TaxId: 562]}
dgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygqweynfq
gnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefggdtaysd
dffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisyeyegfg
ivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpitnkftn
tsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgatyyfnkn
mstyvdyiinqidsdnklgvgsddtvavgivyqf

SCOPe Domain Coordinates for d4lsic_:

Click to download the PDB-style file with coordinates for d4lsic_.
(The format of our PDB-style files is described here.)

Timeline for d4lsic_: