Lineage for d6pcy__ (6pcy -)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) Superfamily b.6.1: Cupredoxins [49503] (5 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Plastocyanin [49507] (14 species) Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (9 PDB entries) 
Domain d6pcy__: 6pcy - [22852]
Details for d6pcy__
PDB Entry: 6pcy (more details), 1.9 Å
PDB Description: crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
SCOP Domain Sequences for d6pcy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pcy__ b.6.1.1 (-) Plastocyanin {Poplar (Populus nigra), variant italica}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn
SCOP Domain Coordinates for d6pcy__:
Click to download the PDB-style file with coordinates for d6pcy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6pcy__:
- d6pcy__ first appeared (with stable ids) in SCOP 1.55
- d6pcy__ appears in SCOP 1.59
- d6pcy__ appears in SCOP 1.63
- d6pcy__ appears in the current release, SCOPe 2.08, called d6pcya_
View in 3D