Lineage for d6pcy__ (6pcy -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11048Protein Plastocyanin [49507] (14 species)
  7. 11078Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (8 PDB entries)
  8. 11085Domain d6pcy__: 6pcy - [22852]

Details for d6pcy__

PDB Entry: 6pcy (more details), 1.9 Å

PDB Description: crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values

SCOP Domain Sequences for d6pcy__:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pcy__ b.6.1.1 (-) Plastocyanin {Poplar (Populus nigra), variant italica}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn

SCOP Domain Coordinates for d6pcy__:

Click to download the PDB-style file with coordinates for d6pcy__.
(The format of our PDB-style files is described here.)

Timeline for d6pcy__: