Lineage for d4lsib_ (4lsi B:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1455213Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 1455275Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 1455276Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 1455277Protein Porin [56937] (5 species)
  7. 1455280Species Escherichia coli, different sequences [TaxId:562] [56938] (25 PDB entries)
  8. 1455299Domain d4lsib_: 4lsi B: [228519]
    automated match to d4gcsa_
    complexed with br, c8e, gol, mg, peg

Details for d4lsib_

PDB Entry: 4lsi (more details), 2.09 Å

PDB Description: Ion selectivity of OmpF porin soaked in 0.3M KBr
PDB Compounds: (B:) Outer membrane protein F

SCOPe Domain Sequences for d4lsib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lsib_ f.4.3.1 (B:) Porin {Escherichia coli, different sequences [TaxId: 562]}
dgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygqweynfq
gnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefggdtaysd
dffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisyeyegfg
ivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpitnkftn
tsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgatyyfnkn
mstyvdyiinqidsdnklgvgsddtvavgivyqf

SCOPe Domain Coordinates for d4lsib_:

Click to download the PDB-style file with coordinates for d4lsib_.
(The format of our PDB-style files is described here.)

Timeline for d4lsib_: