![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.4.3: Porins [56935] (5 families) ![]() |
![]() | Family f.4.3.1: Porin [56936] (2 proteins) trimer, one subunit folds into (16,20) barrel |
![]() | Protein Porin [56937] (5 species) |
![]() | Species Escherichia coli, different sequences [TaxId:562] [56938] (29 PDB entries) |
![]() | Domain d4lsib_: 4lsi B: [228519] automated match to d4gcsa_ complexed with br, c8e, gol, mg, peg |
PDB Entry: 4lsi (more details), 2.09 Å
SCOPe Domain Sequences for d4lsib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lsib_ f.4.3.1 (B:) Porin {Escherichia coli, different sequences [TaxId: 562]} dgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygqweynfq gnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefggdtaysd dffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisyeyegfg ivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpitnkftn tsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgatyyfnkn mstyvdyiinqidsdnklgvgsddtvavgivyqf
Timeline for d4lsib_: