Lineage for d4lseb_ (4lse B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022097Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 3022098Protein Porin [56937] (5 species)
  7. 3022101Species Escherichia coli, different sequences [TaxId:562] [56938] (29 PDB entries)
  8. 3022128Domain d4lseb_: 4lse B: [228517]
    automated match to d4gcsa_
    complexed with br, c8e, mg, peg

Details for d4lseb_

PDB Entry: 4lse (more details), 2.1 Å

PDB Description: Ion selectivity of OmpF porin soaked in 0.2M NaBr
PDB Compounds: (B:) Outer membrane protein F

SCOPe Domain Sequences for d4lseb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lseb_ f.4.3.1 (B:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

SCOPe Domain Coordinates for d4lseb_:

Click to download the PDB-style file with coordinates for d4lseb_.
(The format of our PDB-style files is described here.)

Timeline for d4lseb_: