Lineage for d3pcy__ (3pcy -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Plastocyanin [49507] (14 species) Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (9 PDB entries) 
Domain d3pcy__: 3pcy - [22851]
Details for d3pcy__
PDB Entry: 3pcy (more details), 1.9 Å
PDB Description: the crystal structure of mercury-substituted poplar plastocyanin at 1.9-angstroms resolution
SCOP Domain Sequences for d3pcy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pcy__ b.6.1.1 (-) Plastocyanin {Poplar (Populus nigra), variant italica}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn
SCOP Domain Coordinates for d3pcy__:
Click to download the PDB-style file with coordinates for d3pcy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3pcy__:
- d3pcy__ first appeared (with stable ids) in SCOP 1.55
- d3pcy__ appears in SCOP 1.57
- d3pcy__ appears in SCOP 1.61
- d3pcy__ appears in the current release, SCOPe 2.08, called d3pcya_
View in 3D