Lineage for d3pcya_ (3pcy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770828Protein Plastocyanin [49507] (17 species)
  7. 2770879Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (16 PDB entries)
  8. 2770893Domain d3pcya_: 3pcy A: [22851]
    complexed with hg

Details for d3pcya_

PDB Entry: 3pcy (more details), 1.9 Å

PDB Description: the crystal structure of mercury-substituted poplar plastocyanin at 1.9-angstroms resolution
PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d3pcya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcya_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn

SCOPe Domain Coordinates for d3pcya_:

Click to download the PDB-style file with coordinates for d3pcya_.
(The format of our PDB-style files is described here.)

Timeline for d3pcya_: