Lineage for d4l74a1 (4l74 A:116-244)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106641Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
    automatically mapped to Pfam PF02254
  6. 2106691Protein automated matches [228498] (1 species)
    not a true protein
  7. 2106692Species Methanothermobacter thermautotrophicus [TaxId:187420] [228499] (8 PDB entries)
  8. 2106693Domain d4l74a1: 4l74 A:116-244 [228509]
    Other proteins in same PDB: d4l74a2, d4l74a3, d4l74b2, d4l74b3
    automated match to d1lnqa3
    complexed with ca

Details for d4l74a1

PDB Entry: 4l74 (more details), 1.84 Å

PDB Description: ca2+-bound mthk rck domain at 1.9 angstrom with single ligand
PDB Compounds: (A:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4l74a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l74a1 c.2.1.9 (A:116-244) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv
rgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis
grlmsrsid

SCOPe Domain Coordinates for d4l74a1:

Click to download the PDB-style file with coordinates for d4l74a1.
(The format of our PDB-style files is described here.)

Timeline for d4l74a1: