Lineage for d4l76e1 (4l76 E:115-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845624Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
    automatically mapped to Pfam PF02254
  6. 2845674Protein automated matches [228498] (1 species)
    not a true protein
  7. 2845675Species Methanothermobacter thermautotrophicus [TaxId:187420] [228499] (8 PDB entries)
  8. 2845714Domain d4l76e1: 4l76 E:115-244 [228501]
    Other proteins in same PDB: d4l76a2, d4l76a3, d4l76b2, d4l76b3, d4l76c2, d4l76d2, d4l76d3, d4l76e2, d4l76e3, d4l76f2, d4l76f3
    automated match to d1lnqa3
    complexed with ca, na; mutant

Details for d4l76e1

PDB Entry: 4l76 (more details), 2.99 Å

PDB Description: ca2+-bound e212q mutant mthk rck domain
PDB Compounds: (E:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4l76e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l76e1 c.2.1.9 (E:115-244) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
srhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekan
vrgaravivdlesdsetihcilgirkidesvriiaeaqryenieqlrmagadqvispfvi
sgrlmsrsid

SCOPe Domain Coordinates for d4l76e1:

Click to download the PDB-style file with coordinates for d4l76e1.
(The format of our PDB-style files is described here.)

Timeline for d4l76e1: