Lineage for d5pcy__ (5pcy -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Plastocyanin [49507] (14 species) Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (8 PDB entries) 
Domain d5pcy__: 5pcy - [22850]
Details for d5pcy__
PDB Entry: 5pcy (more details), 1.8 Å
PDB Description: crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
SCOP Domain Sequences for d5pcy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d5pcy__ b.6.1.1 (-) Plastocyanin {Poplar (Populus nigra), variant italica}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn
SCOP Domain Coordinates for d5pcy__:
Click to download the PDB-style file with coordinates for d5pcy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5pcy__:
- d5pcy__ first appeared (with stable ids) in SCOP 1.55
- d5pcy__ appears in SCOP 1.59
- d5pcy__ appears in the current release, SCOPe 2.08, called d5pcya_
View in 3D