SCOPe 2.06: Domain d4kwja_: 4kwj A:

Lineage for d4kwja_ (4kwj A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
   Pfam PF05995, CDO_I

6. Protein Cysteine dioxygenase type I [141616] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (51 PDB entries)

8. Domain d4kwja_: 4kwj A: [228492]
   automated match to d3elna_
   complexed with fe2

Details for d4kwja_

PDB Entry: 4kwj, 1.75 Å

PDB Description: resting state of rat cysteine dioxygenase

PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4kwja_:

Sequence; same for both SEQRES and ATOM records:

>d4kwja_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlv
dqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikkser
tlrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhs
kfgirtp

Timeline for d4kwja_:

• d4kwja_ first appeared in SCOPe 2.03
  
• d4kwja_ appears in SCOPe 2.05
  
• d4kwja_ appears in SCOPe 2.07
  
• d4kwja_ appears in the current release, SCOPe 2.08