Lineage for d2pcya_ (2pcy A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774128Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1774510Protein Plastocyanin [49507] (16 species)
  7. 1774558Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (16 PDB entries)
  8. 1774571Domain d2pcya_: 2pcy A: [22849]

Details for d2pcya_

PDB Entry: 2pcy (more details), 1.8 Å

PDB Description: the crystal structure of poplar apoplastocyanin at 1.8-angstroms resolution. the geometry of the copper-binding site is created by the polypeptide
PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d2pcya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcya_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn

SCOPe Domain Coordinates for d2pcya_:

Click to download the PDB-style file with coordinates for d2pcya_.
(The format of our PDB-style files is described here.)

Timeline for d2pcya_: