Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins) probably stems out from the biMOP domain |
Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species) |
Species Escherichia coli [TaxId:562] [101772] (15 PDB entries) |
Domain d4ki0a2: 4ki0 A:236-371 [228488] Other proteins in same PDB: d4ki0a1, d4ki0a3, d4ki0b1, d4ki0b3, d4ki0e_, d4ki0f1, d4ki0f2, d4ki0g_ automated match to d2awna1 complexed with anp, mg, pgv, umq |
PDB Entry: 4ki0 (more details), 2.38 Å
SCOPe Domain Sequences for d4ki0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ki0a2 b.40.6.3 (A:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]} spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf redgtacrrlhkepgv
Timeline for d4ki0a2: