SCOPe 2.07: Domain d1pnda_: 1pnd A:

Lineage for d1pnda_ (1pnd A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (16 PDB entries)

8. Domain d1pnda_: 1pnd A: [22848]
   complexed with cu

Details for d1pnda_

PDB Entry: 1pnd, 1.6 Å

PDB Description: accuracy and precision in protein crystal structure analysis: two independent refinements of the structure of poplar plastocyanin at 173k

PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d1pnda_:

Sequence; same for both SEQRES and ATOM records:

>d1pnda_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn

Timeline for d1pnda_:

• d1pnda_ first appeared (with stable ids) in SCOP 1.55, called d1pnd__
  
• d1pnda_ appears in SCOPe 2.06
  
• d1pnda_ appears in the current release, SCOPe 2.08