SCOPe 2.03: Domain d4khzb1: 4khz B:2-235

Lineage for d4khzb1 (4khz B:2-235)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)

7. Species Escherichia coli [TaxId:562] [102380] (13 PDB entries)

8. Domain d4khzb1: 4khz B:2-235 [228479]
   Other proteins in same PDB: d4khza2, d4khzb2, d4khze_, d4khzf1, d4khzf2, d4khzg_
   automated match to d2awna2
   complexed with pgv

Details for d4khzb1

PDB Entry: 4khz, 2.9 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose

PDB Compounds: (B:) Binding-protein-dependent transport systems inner membrane component

SCOPe Domain Sequences for d4khzb1:

Sequence; same for both SEQRES and ATOM records:

>d4khzb1 c.37.1.12 (B:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

Timeline for d4khzb1:

• d4khzb1 is new in SCOPe 2.03-stable
  
• d4khzb1 appears in SCOPe 2.04
  
• d4khzb1 appears in the current release, SCOPe 2.08