Lineage for d4khza2 (4khz A:236-371)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1790106Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 1790190Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 1790210Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 1790211Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 1790248Domain d4khza2: 4khz A:236-371 [228478]
    Other proteins in same PDB: d4khza1, d4khzb1, d4khze_, d4khzf1, d4khzf2, d4khzg_
    automated match to d2awna1
    complexed with pgv

Details for d4khza2

PDB Entry: 4khz (more details), 2.9 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose
PDB Compounds: (A:) Binding-protein-dependent transport systems inner membrane component

SCOPe Domain Sequences for d4khza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4khza2 b.40.6.3 (A:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv

SCOPe Domain Coordinates for d4khza2:

Click to download the PDB-style file with coordinates for d4khza2.
(The format of our PDB-style files is described here.)

Timeline for d4khza2: