Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species) |
Species Escherichia coli [TaxId:562] [102380] (15 PDB entries) |
Domain d4khza1: 4khz A:2-235 [228477] Other proteins in same PDB: d4khza2, d4khzb2, d4khze_, d4khzf1, d4khzf2, d4khzg_ automated match to d2awna2 complexed with pgv |
PDB Entry: 4khz (more details), 2.9 Å
SCOPe Domain Sequences for d4khza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4khza1 c.37.1.12 (A:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig
Timeline for d4khza1: