SCOPe 2.07: Domain d4khza1: 4khz A:2-235

Lineage for d4khza1 (4khz A:2-235)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)

7. Species Escherichia coli [TaxId:562] [102380] (15 PDB entries)

8. Domain d4khza1: 4khz A:2-235 [228477]
   Other proteins in same PDB: d4khza2, d4khzb2, d4khze_, d4khzf1, d4khzf2, d4khzg_
   automated match to d2awna2
   complexed with pgv

Details for d4khza1

PDB Entry: 4khz, 2.9 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose

PDB Compounds: (A:) Binding-protein-dependent transport systems inner membrane component

SCOPe Domain Sequences for d4khza1:

Sequence; same for both SEQRES and ATOM records:

>d4khza1 c.37.1.12 (A:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

Timeline for d4khza1:

• d4khza1 first appeared in SCOPe 2.03
  
• d4khza1 appears in SCOPe 2.06
  
• d4khza1 appears in the current release, SCOPe 2.08