SCOPe 2.03: Domain d4k71e2: 4k71 E:177-268

Lineage for d4k71e2 (4k71 E:177-268)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d4k71e2: 4k71 E:177-268 [228472]
   Other proteins in same PDB: d4k71b1, d4k71c_, d4k71e1, d4k71f_
   automated match to d3frua1
   complexed with so4

Details for d4k71e2

PDB Entry: 4k71, 2.4 Å

PDB Description: Crystal structure of a high affinity Human Serum Albumin variant bound to the Neonatal Fc Receptor

PDB Compounds: (E:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d4k71e2:

Sequence; same for both SEQRES and ATOM records:

>d4k71e2 b.1.1.2 (E:177-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvele

Timeline for d4k71e2:

• d4k71e2 is new in SCOPe 2.03-stable
  
• d4k71e2 appears in SCOPe 2.04
  
• d4k71e2 appears in the current release, SCOPe 2.08