Lineage for d4k71e1 (4k71 E:5-176)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1898167Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1898168Protein automated matches [226842] (4 species)
    not a true protein
  7. 1898181Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)
  8. 1898230Domain d4k71e1: 4k71 E:5-176 [228471]
    Other proteins in same PDB: d4k71a1, d4k71a2, d4k71a3, d4k71b2, d4k71c_, d4k71d1, d4k71d2, d4k71d3, d4k71e2, d4k71f_
    automated match to d3frua2
    complexed with so4

Details for d4k71e1

PDB Entry: 4k71 (more details), 2.4 Å

PDB Description: Crystal structure of a high affinity Human Serum Albumin variant bound to the Neonatal Fc Receptor
PDB Compounds: (E:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d4k71e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k71e1 d.19.1.0 (E:5-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswyweke
ttdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkq
gtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

SCOPe Domain Coordinates for d4k71e1:

Click to download the PDB-style file with coordinates for d4k71e1.
(The format of our PDB-style files is described here.)

Timeline for d4k71e1: