Lineage for d4kgbb1 (4kgb B:34-278)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151246Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2151247Protein automated matches [191112] (14 species)
    not a true protein
  7. 2151323Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [228466] (1 PDB entry)
  8. 2151326Domain d4kgbb1: 4kgb B:34-278 [228468]
    automated match to d3dlxb1
    complexed with so4

Details for d4kgbb1

PDB Entry: 4kgb (more details), 2.64 Å

PDB Description: Structure of succinyl-CoA: 3-ketoacid CoA transferase from Drosophila melanogaster
PDB Compounds: (B:) succinyl-coa:3-ketoacid-coenzyme a transferase

SCOPe Domain Sequences for d4kgbb1:

Sequence, based on SEQRES records: (download)

>d4kgbb1 c.124.1.0 (B:34-278) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gkiyesaidavadvqdgaqilfggfgicgipekminalkqkgvknitgvsnnggvddtgl
gvlikqkqvskvigsyvgentelvrqylegelaveltpqgtlaekiraggagipafytpt
gyatlvqeggapikyskdgkveissekkpvkefngknyvmeesifadfafvkaqkadplg
nlvfnkaarnfnapmcraakitvaeveeivpigalspdeihvpgiyinrifkgtnynkrv
erlri

Sequence, based on observed residues (ATOM records): (download)

>d4kgbb1 c.124.1.0 (B:34-278) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gkiyesaidavadvqdgaqilfggfgicgipekminalkqkgvknitgvsnnggvddtgl
gvlikqkqvskvigsyvgentelvrqylegelaveltpqgtlaekiraggagipafytpt
gyatlvqeggapikysgkveissekkpvkefngknyvmeesifadfafvkaqkadplgnl
vfnkaarnfnapmcraakitvaeveeivpigalspdeihvpgiyinrifkgtnynkrver
lri

SCOPe Domain Coordinates for d4kgbb1:

Click to download the PDB-style file with coordinates for d4kgbb1.
(The format of our PDB-style files is described here.)

Timeline for d4kgbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kgbb2