Lineage for d4jwla1 (4jwl A:56-247)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726245Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2726283Family a.118.3.0: automated matches [191673] (1 protein)
    not a true family
  6. 2726284Protein automated matches [191283] (3 species)
    not a true protein
  7. 2726288Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries)
  8. 2726295Domain d4jwla1: 4jwl A:56-247 [228461]
    Other proteins in same PDB: d4jwla2
    automated match to d1ku1a_
    complexed with hrc

Details for d4jwla1

PDB Entry: 4jwl (more details), 1.95 Å

PDB Description: Complexe of ARNO Sec7 domain with the protein-protein interaction inhibitor N-(4-hydroxy-2,6-dimethylphenyl)benzenesulfonamide at pH7.5
PDB Compounds: (A:) Cytohesin-2

SCOPe Domain Sequences for d4jwla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jwla1 a.118.3.0 (A:56-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdyl
gereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcn
pgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrnly
dsirnepfkipe

SCOPe Domain Coordinates for d4jwla1:

Click to download the PDB-style file with coordinates for d4jwla1.
(The format of our PDB-style files is described here.)

Timeline for d4jwla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jwla2