Lineage for d1plc__ (1plc -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 553581Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 553582Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 553583Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 553803Protein Plastocyanin [49507] (14 species)
  7. 553836Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (9 PDB entries)
  8. 553837Domain d1plc__: 1plc - [22846]
    complexed with cu

Details for d1plc__

PDB Entry: 1plc (more details), 1.33 Å

PDB Description: accuracy and precision in protein crystal structure analysis: restrained least-squares refinement of the crystal structure of poplar plastocyanin at 1.33 angstroms resolution

SCOP Domain Sequences for d1plc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plc__ b.6.1.1 (-) Plastocyanin {Poplar (Populus nigra), variant italica}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn

SCOP Domain Coordinates for d1plc__:

Click to download the PDB-style file with coordinates for d1plc__.
(The format of our PDB-style files is described here.)

Timeline for d1plc__: